Recombinant Mycobacterium Tuberculosis CFP21 Protein (33-217 aa), His-SUMO-Myc-tagged
Cat.No. : | CFP21-2292M |
Product Overview : | Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) CFP21 Protein (33-217 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 33-217 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 38.7 kDa |
AA Sequence : | DPCSDIAVVFARGTHQASGLGDVGEAFVDSLTSQVGGRSIGVYAVNYPASDDYRASASNGSDDASAHIQRTVASCPNTRIVLGGYSQGATVIDLSTSAMPPAVADHVAAVALFGEPSSGFSSMLWGGGSLPTIGPLYSSKTINLCAPDDPICTGGGNIMAHVSYVQSGMTSQAATFAANRLDHAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | cfp21 cutinase [ Mycobacterium tuberculosis H37Rv ] |
Official Symbol | CFP21 |
Synonyms | Rv1984c; clp1; culp1; |
Gene ID | 885813 |
Protein Refseq | NP_216500 |
UniProt ID | P9WP43 |
◆ Recombinant Proteins | ||
CFP21-2292M | Recombinant Mycobacterium Tuberculosis CFP21 Protein (33-217 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP21 Products
Required fields are marked with *
My Review for All CFP21 Products
Required fields are marked with *
0
Inquiry Basket