Recombinant Mycobacterium Tuberculosis CFP21 Protein (33-217 aa), His-SUMO-Myc-tagged

• Cat.No.: CFP21-2292M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) CFP21 Protein (33-217 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mycobacterium Tuberculosis
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 33-217 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 38.7 kDa
• AA Sequence: DPCSDIAVVFARGTHQASGLGDVGEAFVDSLTSQVGGRSIGVYAVNYPASDDYRASASNGSDDASAHIQRTVASCPNTRIVLGGYSQGATVIDLSTSAMPPAVADHVAAVALFGEPSSGFSSMLWGGGSLPTIGPLYSSKTINLCAPDDPICTGGGNIMAHVSYVQSGMTSQAATFAANRLDHAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: cfp21 cutinase [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: CFP21
• Synonyms: Rv1984c; clp1; culp1
• Gene ID: 885813
• Protein Refseq: NP_216500
• UniProt ID: P9WP43