Recombinant Mycobacterium tuberculosis MCAN_RS08620 Protein
| Cat.No. : | MCAN_RS08620-70M |
| Product Overview : | Recombinant Mycobacterium tuberculosis MCAN_RS08620 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mycobacterium tuberculosis |
| Source : | E.coli |
| Description : | universal stress protein |
| Form : | Liquid. In PBS (pH 7.4). |
| Molecular Mass : | ~15.3 kDa |
| AA Sequence : | MSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPQHEDARAADILKDESYKVTGTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 2.0 mg/ml |
| Gene Name | MCAN_RS08620 universal stress protein [ Mycobacterium canettii CIPT 140010059 ] |
| Official Symbol | MCAN_RS08620 |
| Gene ID | 45425605 |
| Protein Refseq | WP_003408085 |
| UniProt ID | P9WFC8 |
| ◆ Recombinant Proteins | ||
| MCAN_RS08620-70M | Recombinant Mycobacterium tuberculosis MCAN_RS08620 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCAN_RS08620 Products
Required fields are marked with *
My Review for All MCAN_RS08620 Products
Required fields are marked with *
Recently Viewed
