Recombinant Mycobacterium Tuberculosis RECR Protein (1-203 aa), His-tagged
| Cat.No. : | RECR-2214M |
| Product Overview : | Recombinant Mycobacterium Tuberculosis (strain ATCC 25177/H37Ra) RECR Protein (1-203 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mycobacterium Tuberculosis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-203 aa |
| Description : | May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 26.1 kDa |
| AA Sequence : | MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Synonyms | recR; |
| UniProt ID | A5U941 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RECR Products
Required fields are marked with *
My Review for All RECR Products
Required fields are marked with *



