Recombinant Mycobacterium Tuberculosis RELG Protein (1-87 aa), His-SUMO-tagged

Cat.No. : RELG-2216M
Product Overview : Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) RELG Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mycobacterium Tuberculosis
Source : E.coli
Tag : His&SUMO
Protein Length : 1-87 aa
Description : Toxic component of a toxin-antitoxin (TA) module. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis). Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.2 kDa
AA Sequence : MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name relG toxin RelG [ Mycobacterium tuberculosis H37Rv ]
Official Symbol RELG
Synonyms relG; Putative endoribonuclease RelG; relE2;
Gene ID 887450
Protein Refseq NP_217382
UniProt ID O33348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RELG Products

Required fields are marked with *

My Review for All RELG Products

Required fields are marked with *

0
cart-icon
0
compare icon