Recombinant Mycoplasma Pneumoniae PEPF Protein (1-210 aa), His-SUMO-tagged
| Cat.No. : | PEPF-2019M |
| Product Overview : | Recombinant Mycoplasma Pneumoniae (strain ATCC 29342/M129) PEPF Protein (1-210 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mycoplasma Pneumoniae |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-210 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.6 kDa |
| AA Sequence : | MNNQYNWNLEVLLNGKSLADNFTELKQLSEQEKALYDGGACFQTKAKFTEFLQLQEKIEVLENRYSNFLSNKHAENSLDKTINDALFQYEMFKSEHALVFVDFEKNLFKHEKVIRAYLQDPALKQYQRDFELVWRNKKHQIDPASQKLLAQISPAWNQADKIFNVLSTADLNLQPVVYKGKTYVINAVSDYQSLLENKDRGLREAAYKVW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | pepF oligoendopeptidase F [ Mycoplasma pneumoniae M129 ] |
| Official Symbol | PEPF |
| Synonyms | pepF; GT9_orf611; |
| Gene ID | 876899 |
| Protein Refseq | NP_109885 |
| UniProt ID | P54125 |
| ◆ Recombinant Proteins | ||
| PEPF-1000B | Recombinant Bacillus subtilis PEPF protein, His-tagged | +Inquiry |
| PEPF-2019M | Recombinant Mycoplasma Pneumoniae PEPF Protein (1-210 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PEPF Products
Required fields are marked with *
My Review for All PEPF Products
Required fields are marked with *
