Recombinant N. meningitidis Major outer membrane protein P.IB Protein, His-SUMO-tagged
Cat.No. : | porB-1337N |
Product Overview : | Recombinant N. meningitidis serogroup B Major outer membrane protein P.IB Protein (20-331aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | N.meningitidis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-331 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Major outer membrane protein P.IB |
Official Symbol | Major outer membrane protein P.IB |
Synonyms | Major outer membrane protein P.IB; porB; Protein IB; PIB; Class 3 protein; Porin |
UniProt ID | E6MZM0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Major outer membrane protein P.IB Products
Required fields are marked with *
My Review for All Major outer membrane protein P.IB Products
Required fields are marked with *