Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 PORB Protein (20-331 aa), His-SUMO-tagged
| Cat.No. : | PORB-2094N |
| Product Overview : | Recombinant Neisseria Meningitidis Serogroup B/Serotype 15 (strain H44/76)) PORB Protein (20-331 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Neisseria Meningitidis Serogroup B/Serotype 15 |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-331 aa |
| Description : | Serves as a slightly cation selective porin. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 49.8 kDa |
| AA Sequence : | DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | porB major outer membrane protein PIB [ Neisseria meningitidis MC58 ] |
| Official Symbol | PORB |
| Synonyms | porB; Class 3 protein Porin; |
| Gene ID | 904054 |
| UniProt ID | E6MZM0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PORB Products
Required fields are marked with *
My Review for All PORB Products
Required fields are marked with *



