Recombinant Neosartorya Fumigata ASPF3 Protein (1-168 aa), His-SUMO-tagged

Cat.No. : ASPF3-1998N
Product Overview : Recombinant Neosartorya Fumigata (strain ATCC MYA-4609/Af293/CBS 101355/FGSC A1100) (Aspergillus fumigatus) ASPF3 Protein (1-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Allergen. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Neosartorya Fumigata
Source : E.coli
Tag : His&SUMO
Protein Length : 1-168 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.5 kDa
AA Sequence : MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms aspf3; Peroxisomal membrane protein pmp20 Thioredoxin reductase Allergen: Asp f 3;
UniProt ID O43099

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASPF3 Products

Required fields are marked with *

My Review for All ASPF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon