Recombinant Neurospora Crassa NCU05495 Protein (1-111 aa), His-tagged

Cat.No. : NCU05495-2431N
Product Overview : Recombinant Neurospora Crassa (strain ATCC 24698/74-OR23-1A/CBS 708.71/DSM 1257/FGSC 987) NCU05495 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Neurospora Crassa
Source : E.coli
Tag : His
Protein Length : 1-111 aa
Description : Mannose-binding lectin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.9 kDa
AA Sequence : MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms NCU05495;
UniProt ID Q7S6U4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCU05495 Products

Required fields are marked with *

My Review for All NCU05495 Products

Required fields are marked with *

0
cart-icon
0
compare icon