Recombinant Nosema Bombycis PTP3 Protein (710-1320 aa), GST-tagged
Cat.No. : | PTP3-1252N |
Product Overview : | Recombinant Nosema Bombycis PTP3 Protein (710-1320 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nosema Bombycis |
Source : | E.coli |
Tag : | GST |
Protein Length : | 710-1320 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 93.7 kDa |
AA Sequence : | DEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENSKKIHIDEATAYFKPAAKLKMEKKGIKTDNFRPKTNQGEIRDMPKGETYYEVDLKDADLSLPSPTNPTPDTLVSNGKDVVDVEDVSAIVINKGTLVQTPWNEYSDMIKPKFNPYPNEGEKINQIKKLQKLIADEKRKDTLDRIKVNTITNPDGEKRMIVNTPYGVQEMFEETEGMKRLSHIDPNKNVAISETPTDDNKESIYSAFKNVSPNEAVGKFIEDTFNSAYSSGQAQRFVNPTNAFTGQEDPKKARLMTQKTIDVTEYYINDGKPSSAIKNQLIQNYRALADSLGMTEEDFIQFARKIPDDSLAQMISYNEQSESSRPALVDAPFFKTLQPLANQTSKTKLNDIIKIIFTQISKVTGKTNSTTGTTLEKKIVPNLKAVRSDQVIAGPNGGTSALSQATAPRTGSTVLSKQITRGLPRVPSGTGTSYPVRDPNGINTSEDNERYKVNPYNPYSKSDTSGLEAPGGEIVHNGTRPSPYAIVGVPIVAAVTTPVIRPAVLRTPPAAQSSSSALQGNTALTGAGTPRAGVAGSPGVNPGPT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Synonyms | PTP3; |
UniProt ID | R0KX08 |
◆ Recombinant Proteins | ||
PTP3-1252N | Recombinant Nosema Bombycis PTP3 Protein (710-1320 aa), GST-tagged | +Inquiry |
PTP3-5278N | Recombinant Nosema bombycis PTP3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTP3 Products
Required fields are marked with *
My Review for All PTP3 Products
Required fields are marked with *
0
Inquiry Basket