Recombinant Onchocerca Volvulus OV16 Protein (17-197 aa), His-tagged
Cat.No. : | OV16-1600O |
Product Overview : | Recombinant Onchocerca Volvulus OV16 Protein (17-197 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Onchocerca Volvulus |
Source : | Yeast |
Tag : | His |
Protein Length : | 17-197 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.0 kDa |
AA Sequence : | KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | OV16; |
UniProt ID | P31729 |
◆ Recombinant Proteins | ||
OV16-0601O | Recombinant Onchocerca volvulus OV16 protein, Avi-GST-tagged, Biotinylated | +Inquiry |
OV16-0600O | Recombinant Onchocerca volvulus OV16 protein, GST-tagged | +Inquiry |
OV16-4037O | Recombinant Onchocerca volvulus OV16 protein, His-tagged | +Inquiry |
OV16-1600O | Recombinant Onchocerca Volvulus OV16 Protein (17-197 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OV16 Products
Required fields are marked with *
My Review for All OV16 Products
Required fields are marked with *