| Species : |
Ovine |
| Source : |
Yeast |
| Tag : |
Non |
| Protein Length : |
172 |
| Description : |
IFN-τ is a new class of type I IFN that is secreted by the trophoblast and is the signal for maternal recognition of pregnancy in sheep. IFN-τ has potent immunosuppressive and antiviral activities similar to other type I IFN but is less cytotoxic than IFN-α/β. The current investigation concerns the effect of recombinant ovine IFN-tau (rOvIFN-τ) on the modulation of MHC class I and II expression on cloned mouse cerebrovascular endothelial (CVE) cells. IFN-tau induced tyrosine phosphorylation of Stat1 and up regulated the expression of MHC class I on CVE. One proposed action by which type I IFN reduce the relapse rate in MS is via interference with IFN-γ-induced MHC class II expression. IFN-τwas shown to down regulate IFN-γ-induced MHC class II expression on CVE and, hence, may be of potential therapeutic value in down regulating inflammation in the central nervous system (CNS). IFN-τdid not upregulate the expression of MHC class II on CVE. IFN-τalso inhibited the replication of Theiler's virus in CVE. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to IFN-alpha. The specific activity determined by a viral resistance assay is no less than 1.0 × 10⁷ IU/mg. |
| Molecular Mass : |
Approximately 19.9 kDa, a single glycosylated polypeptide chain containing 172 amino acids. |
| AA Sequence : |
CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP |
| Endotoxin : |
Less than 0.1 EU/µg of rOvIFN-τ as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |