Recombinant Ovine IFNT protein
Cat.No. : | IFNT-29O |
Product Overview : | Recombinant Ovine IFNT protein was expressed in Yeast |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ovine |
Source : | Yeast |
Tag : | Non |
Protein Length : | 172 |
Description : | IFN-τ is a new class of type I IFN that is secreted by the trophoblast and is the signal for maternal recognition of pregnancy in sheep. IFN-τ has potent immunosuppressive and antiviral activities similar to other type I IFN but is less cytotoxic than IFN-α/β. The current investigation concerns the effect of recombinant ovine IFN-tau (rOvIFN-τ) on the modulation of MHC class I and II expression on cloned mouse cerebrovascular endothelial (CVE) cells. IFN-tau induced tyrosine phosphorylation of Stat1 and up regulated the expression of MHC class I on CVE. One proposed action by which type I IFN reduce the relapse rate in MS is via interference with IFN-γ-induced MHC class II expression. IFN-τwas shown to down regulate IFN-γ-induced MHC class II expression on CVE and, hence, may be of potential therapeutic value in down regulating inflammation in the central nervous system (CNS). IFN-τdid not upregulate the expression of MHC class II on CVE. IFN-τalso inhibited the replication of Theiler's virus in CVE. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to IFN-alpha. The specific activity determined by a viral resistance assay is no less than 1.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 19.9 kDa, a single glycosylated polypeptide chain containing 172 amino acids. |
AA Sequence : | CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP |
Endotoxin : | Less than 0.1 EU/µg of rOvIFN-τ as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNT |
Official Symbol | IFNT |
Gene ID | 100144750 |
mRNA Refseq | NM_001123399.1 |
Protein Refseq | NP_001116871.1 |
UniProt ID | P56828 |
◆ Recombinant Proteins | ||
IFNT-29O | Recombinant Ovine IFNT protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNT Products
Required fields are marked with *
My Review for All IFNT Products
Required fields are marked with *
0
Inquiry Basket