Recombinant Ovine IFNT protein

Cat.No. : IFNT-29O
Product Overview : Recombinant Ovine IFNT protein was expressed in Yeast
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Ovine
Source : Yeast
Tag : Non
Protein Length : 172
Description : IFN-τ is a new class of type I IFN that is secreted by the trophoblast and is the signal for maternal recognition of pregnancy in sheep. IFN-τ has potent immunosuppressive and antiviral activities similar to other type I IFN but is less cytotoxic than IFN-α/β. The current investigation concerns the effect of recombinant ovine IFN-tau (rOvIFN-τ) on the modulation of MHC class I and II expression on cloned mouse cerebrovascular endothelial (CVE) cells. IFN-tau induced tyrosine phosphorylation of Stat1 and up regulated the expression of MHC class I on CVE. One proposed action by which type I IFN reduce the relapse rate in MS is via interference with IFN-γ-induced MHC class II expression. IFN-τwas shown to down regulate IFN-γ-induced MHC class II expression on CVE and, hence, may be of potential therapeutic value in down regulating inflammation in the central nervous system (CNS). IFN-τdid not upregulate the expression of MHC class II on CVE. IFN-τalso inhibited the replication of Theiler's virus in CVE.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to IFN-alpha. The specific activity determined by a viral resistance assay is no less than 1.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 19.9 kDa, a single glycosylated polypeptide chain containing 172 amino acids.
AA Sequence : CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP
Endotoxin : Less than 0.1 EU/µg of rOvIFN-τ as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IFNT
Official Symbol IFNT
Gene ID 100144750
mRNA Refseq NM_001123399.1
Protein Refseq NP_001116871.1
UniProt ID P56828

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNT Products

Required fields are marked with *

My Review for All IFNT Products

Required fields are marked with *

0
cart-icon
0
compare icon