Recombinant P. aeruginosa rhlR Protein, His-SUMO/MYC-tagged
| Cat.No. : | rhlR-1354P |
| Product Overview : | Recombinant P. aeruginosa rhlR Protein (1-241aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | P.aeruginosa |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-241 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLE RYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQSRMLWNEARDWGLCVGATLPIRAPNNLLSVLSVARDQ QNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADGKSSGEIAIILSISES TVNFHHKNIQKKFDAPNKTLAAAYAAALGLI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | rhlR transcriptional regulator RhlR [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol | rhlR |
| Synonyms | transcriptional regulator RhlR; Regulatory protein RhlR; rhlR; lasM; vsmR |
| Gene ID | 878968 |
| Protein Refseq | NP_252167.1 |
| UniProt ID | P54292 |
| ◆ Recombinant Proteins | ||
| rhlR-1354P | Recombinant P. aeruginosa rhlR Protein, His-SUMO/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All rhlR Products
Required fields are marked with *
My Review for All rhlR Products
Required fields are marked with *
