Recombinant Pacific electric ray CHRNA1 protein(25-234aa)
Cat.No. : | CHRNA1-292P |
Product Overview : | Recombinant Pacific electric ray CHRNA1 protein(P02710)(25-234aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pacific electric ray |
Source : | E.coli |
Tag : | Non |
Protein Length : | 25-234aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI |
◆ Recombinant Proteins | ||
CHRNA1-2695H | Recombinant Human CHRNA1 protein, His-Trx-tagged | +Inquiry |
CHRNA1-1047R | Recombinant Rat CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA1-30388TH | Recombinant Human CHRNA1 | +Inquiry |
CHRNA1-1515T | Recombinant Torpedo californica CHRNA1 protein, His-tagged | +Inquiry |
CHRNA1-5379H | Recombinant Human CHRNA1 protein, His-PDI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
0
Inquiry Basket