Recombinant Partial Human KIT (D816V) protein, GST-tagged

Cat.No. : KIT-31H
Product Overview : Recombinant Human KIT D816V partial mutated protein (754 a.a. - 875 a.a.) fused with GST, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 754-875 a.a.
Form : 20 mM PBS, 150 mM ClNa, pH 7,2 ; without BSA and Azide
Molecular Mass : 37 kDa
AA Sequence : PAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARVIKNDSNYVVKGN ARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPV
Purity : >90 % as determined by SDS-PAGE analysis
Applications : ELISA, WB, Antibody Production, Protein array
Storage : Store at - 80 °C. Avoid repeated freeze/thaw cycles
Gene Name KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ]
Official Symbol KIT
Synonyms KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit;
Gene ID 3815
mRNA Refseq NM_000222
Protein Refseq NP_000213
MIM 164920
UniProt ID P10721
Chromosome Location 4q11-q12
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIT Products

Required fields are marked with *

My Review for All KIT Products

Required fields are marked with *

0
cart-icon