"KIT" Related Products

Expand
Expand

Recombinant Partial Human KIT (D816V) protein, GST-tagged

Cat.No.: KIT-31H
Product Overview: Recombinant Human KIT D816V partial mutated protein (754 a.a. - 875 a.a.) fused with GST, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: GST
Form: 20 mM PBS, 150 mM ClNa, pH 7,2 ; without BSA and Azide
Molecular Mass: 37 kDa
AA Sequence: PAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARVIKNDSNYVVKGN ARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPV
Purity: >90 % as determined by SDS-PAGE analysis
Applications: ELISA, WB, Antibody Production, Protein array
Storage: Store at - 80 °C. Avoid repeated freeze/thaw cycles
Gene Name: KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ]
Official Symbol: KIT
Synonyms: KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit;
Gene ID: 3815
mRNA Refseq: NM_000222
Protein Refseq: NP_000213
MIM: 164920
UniProt ID: P10721
Chromosome Location: 4q11-q12
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function: ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.