Recombinant Partial Human KIT (D816V) protein, GST-tagged
Cat.No. : | KIT-31H |
Product Overview : | Recombinant Human KIT D816V partial mutated protein (754 a.a. - 875 a.a.) fused with GST, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 754-875 a.a. |
Form : | 20 mM PBS, 150 mM ClNa, pH 7,2 ; without BSA and Azide |
Molecular Mass : | 37 kDa |
AA Sequence : | PAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARVIKNDSNYVVKGN ARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPV |
Purity : | >90 % as determined by SDS-PAGE analysis |
Applications : | ELISA, WB, Antibody Production, Protein array |
Storage : | Store at - 80 °C. Avoid repeated freeze/thaw cycles |
Gene Name | KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ] |
Official Symbol | KIT |
Synonyms | KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit; |
Gene ID | 3815 |
mRNA Refseq | NM_000222 |
Protein Refseq | NP_000213 |
MIM | 164920 |
UniProt ID | P10721 |
Chromosome Location | 4q11-q12 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function | ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell |
◆ Recombinant Proteins | ||
KIT-818H | Active Recombinant Human KIT, GST-tagged | +Inquiry |
KIT-3947HF | Recombinant Human KIT Protein, His-tagged, FITC conjugated | +Inquiry |
KIT-27174TH | Recombinant Human KIT, His-tagged | +Inquiry |
KIT-152H | Recombinant Human KIT Protein, DYKDDDDK-tagged | +Inquiry |
KIT-2409R | Active Recombinant Rhesus KIT protein(Met1-Thr520), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIT-001HCL | Recombinant Human KIT cell lysate | +Inquiry |
KIT-463HCL | Recombinant Human KIT cell lysate | +Inquiry |
KIT-1324RCL | Recombinant Rat KIT cell lysate | +Inquiry |
KIT-1405RCL | Recombinant Rat KIT cell lysate | +Inquiry |
KIT-2114MCL | Recombinant Mouse KIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIT Products
Required fields are marked with *
My Review for All KIT Products
Required fields are marked with *