Recombinant Partial Human KIT (D816V) protein, GST-tagged KIT-31H

Recombinant Partial Human KIT (D816V) protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Partial Human KIT (D816V) protein, GST-tagged

Recombinant Partial Human KIT (D816V) protein, GST-tagged

KIT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : KIT-31H
Product Overview : Recombinant Human KIT D816V partial mutated protein (754 a.a. - 875 a.a.) fused with GST, was expressed in E. coli.
Source : E. coli
Species : Human
Tag : GST
Form : 20 mM PBS, 150 mM ClNa, pH 7,2 ; without BSA and Azide
Molecular Mass : 37 kDa
AA Sequence : PAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARVIKNDSNYVVKGN ARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPV
Purity : >90 % as determined by SDS-PAGE analysis
Applications : ELISA, WB, Antibody Production, Protein array
Storage : Store at - 80 °C. Avoid repeated freeze/thaw cycles
Gene Name : KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ]
Official Symbol : KIT
Synonyms : KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit;
Gene ID : 3815
mRNA Refseq : NM_000222
Protein Refseq : NP_000213
MIM : 164920
UniProt ID : P10721
Chromosome Location : 4q11-q12
Pathway : Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function : ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy