Recombinant Partial Human KIT (D816V) protein, GST-tagged

• Cat.No.: KIT-31H
• Product Overview: Recombinant Human KIT D816V partial mutated protein (754 a.a. - 875 a.a.) fused with GST, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 754-875 a.a.
• Form: 20 mM PBS, 150 mM ClNa, pH 7,2 ; without BSA and Azide
• Molecular Mass: 37 kDa
• AA Sequence: PAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARVIKNDSNYVVKGN ARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPV
• Purity: >90 % as determined by SDS-PAGE analysis
• Applications: ELISA, WB, Antibody Production, Protein array
• Storage: Store at - 80 °C. Avoid repeated freeze/thaw cycles

Gene Information

• Gene Name: KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog [ Homo sapiens ]
• Official Symbol: KIT
• Synonyms: KIT; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; PBT, piebald trait; mast/stem cell growth factor receptor Kit; C Kit; CD117; SCFR; p145 c-kit; proto-oncogene c-Kit; piebald trait protein; soluble KIT variant 1; tyrosine-protein kinase Kit; proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; PBT; C-Kit
• Gene ID: 3815
• mRNA Refseq: NM_000222
• Protein Refseq: NP_000213
• MIM: 164920
• UniProt ID: P10721
• Chromosome Location: 4q11-q12
• Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem
• Function: ATP binding; cytokine binding; metal ion binding; nucleotide binding; protease binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; stem cell