Recombinant Pentadiplandra brazzeana Brazzein Protein, Tag Free

• Cat.No.: Brazzein-56P
• Product Overview: Recombinant Pentadiplandra brazzeana Brazzein Protein without tag was expressed in Yeast (animal free media and environment).

Specification

• Species: Pentadiplandra brazzeana
• Source: Yeast
• Tag: Non
• Description: Brazzein is a small protein derived from the African plant Pentadiplandra brazzeana (1). It has sweet taste and is very heat-stable. Sweet taste has been shown to be mediated by a heterodimeric G protein coupled receptor composed of two proteins, T1R2 and T1R3. These proteins have significant homology to a brain metabotropic glutamate receptor, mGluR1, which functions as a homodimer. The ligand binding domain has been compared to a clamshell or a Venus flytrap, having two lobes that form the glutamate binding site. In the absence of ligand, both monomers have very open binding sites. In the ligand-activated form, one mGluR1 chain exhibits a rather closed conformation, and the other has an open binding site.
• Tag: Non
• Form: Lyophilized
• Molecular Mass: 6.4 kDa
• AA Sequence: DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
• Endotoxin: < 0.2 EU/μg of protein as determined by the LAL method.
• Purity: 0.98
• Storage: Stable for at least one year at -20 centigrade. Upon reconstitution Brazzein can be stored at +4 centigrade for 1 week or at -20 centigrade for 6 months.
• Concentration: 100 μg/μL
• Storage Buffer: Potassium Phosphate-buffer, pH 7.0
• Reconstitution: Spin the vial briefly, add distilled sterile water.
• References: 1. Nelson G, Hoon MA, Chandrashekar J, Zhang Y, Ryba NJ, Zuker CS. Mammalian sweet taste receptors. Cell. 2001;106:381–390.
  DE Walters, G Hellekant Interactions of the Sweet Protein Brazzein with the Sweet Taste Receptor J Agric Food Chem. 2006 Dec 27; 54(26): 10129–10133

Gene Information

• Official Symbol: Brazzein
• Synonyms: DEF_PENBA; Defensin-like protein; Brazzein
• UniProt ID: P56552