Recombinant Phleum pratense Pollen allergen Phl p 5b Protein, His-SUMO-tagged
| Cat.No. : | Phlp5b-1334P |
| Product Overview : | Recombinant Phleum pratense Pollen allergen Phl p 5b Protein (20-284aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Phleum pratense |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-284 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAP GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIID KIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKY AVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Pollen allergen Phl p 5b |
| Official Symbol | Pollen allergen Phl p 5b |
| Synonyms | Pollen allergen Phl p 5b; Allergen Phl p Vb; Phl p 5b; Phlp5b; Allergen |
| UniProt ID | Q40963 |
| ◆ Recombinant Proteins | ||
| Phlp5b-1334P | Recombinant Phleum pratense Pollen allergen Phl p 5b Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Phlp5b Products
Required fields are marked with *
My Review for All Phlp5b Products
Required fields are marked with *
