"EPO" Related Products

Expand
Expand

Recombinant Pig EPO Protein, His-tagged

Cat.No. : EPO-1203P
Product Overview : Recombinant Pig EPO Protein (27-194aa) was expressed in yeast with N-terminal 6X His-tag.
Source : Yeast
Species : Pig
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 20.6 kDa
AA Sequence : APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALL
SEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTL
CKLFRNYSNFLRGKLTLYTGEACRRRDR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : EPO erythropoietin [ Sus scrofa (pig) ]
Official Symbol : EPO
Synonyms : EPO; erythropoietin; EP; MVCD2; epoetin
Gene ID : 397249
mRNA Refseq : NM_214134.1
Protein Refseq : NP_999299.1
UniProt ID : P49157

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.