Recombinant Pig EPO Protein, His-tagged
| Cat.No. : | EPO-1203P |
| Product Overview : | Recombinant Pig EPO Protein (27-194aa) was expressed in yeast with N-terminal 6X His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-194 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 20.6 kDa |
| AA Sequence : | APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALL SEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTL CKLFRNYSNFLRGKLTLYTGEACRRRDR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | EPO erythropoietin [ Sus scrofa (pig) ] |
| Official Symbol | EPO |
| Synonyms | EPO; erythropoietin; EP; MVCD2; epoetin |
| Gene ID | 397249 |
| mRNA Refseq | NM_214134.1 |
| Protein Refseq | NP_999299.1 |
| UniProt ID | P49157 |
| ◆ Recombinant Proteins | ||
| EPO-578R | Active Recombinant Rat EPO, His-tagged | +Inquiry |
| EPO-487H | Recombinant Human EPO Protein | +Inquiry |
| Epo-1433M | Recombinant Mouse Epo Protein, His&GST-tagged | +Inquiry |
| EPO-252H | Recombinant Human EPO, StrepII-tagged | +Inquiry |
| EPO-124E | Active Recombinant Human EPO alpha Protein (165 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
| EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *



