Recombinant Pig GH1 protein, His&Myc-tagged
Cat.No. : | GH1-2958P |
Product Overview : | Recombinant Pig GH1 protein(P01248)(1-216aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-216aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GH1 growth hormone 1 [ Sus scrofa ] |
Official Symbol | GH1 |
Synonyms | GH1; growth hormone 1; somatotropin; GH; |
Gene ID | 396884 |
mRNA Refseq | NM_213869 |
Protein Refseq | NP_999034 |
◆ Recombinant Proteins | ||
GH1-1553H | Recombinant human GH1, Active | +Inquiry |
GH1-007H | Recombinant Human GH1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GH1-2514H | Recombinant Human GH1 protein(27-217 aa), N-MBP & C-His-tagged | +Inquiry |
GH1-382H | Recombinant Human Growth Hormone 1, His-tagged | +Inquiry |
GH1-457H | Recombinant Human GH1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *