Recombinant Pig MB protein, His-tagged
Cat.No. : | MB-746P |
Product Overview : | Recombinant Pig MB protein(P02189)(2-154aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-154a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG |
Gene Name | MB myoglobin [ Sus scrofa ] |
Official Symbol | MB |
Synonyms | MB; myoglobin; |
Gene ID | 397467 |
mRNA Refseq | NM_214236 |
Protein Refseq | NP_999401 |
◆ Recombinant Proteins | ||
MB-72S | Recombinant Sperm Whale MB Protein, His-tagged | +Inquiry |
MB-3257R | Recombinant Rat MB Protein, His (Fc)-Avi-tagged | +Inquiry |
MB-4027C | Recombinant Chicken MB | +Inquiry |
Mb-2682R | Recombinant Rat Mb protein, His-tagged | +Inquiry |
MB-58H | Recombinant Human Myoglobin, His-tagged | +Inquiry |
◆ Native Proteins | ||
Mb-8232R | Native Rat Myoglobin | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *