Recombinant Human MB Protein, His-tagged

Cat.No. : MB-01H
Product Overview : Recombinant Human Myoglobin produced in E. coli cells is a single non-glycosylated polypeptide chain containing 166 amino acids. rhMyoglobin has a molecular mass of 18.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Myoglobin, a member of the globin family of proteins, is a cytosolic oxygen-binding protein that regulates the storage and diffusion of oxygen within myocytes. The largest expression of myoglobin is in skeletal and cardiac muscle. Myoglobin exhibits various functions in relation to the muscular oxygen supply, such as oxygen storage, facilitated diffusion, and myoglobin-mediated oxidative phosphorylation. Myoglobin is the primary oxygen-carrying pigment of muscle tissues. High concentrations of myoglobin in muscle cells allow organisms to hold their breath for a longer period of time. Diving mammals such as whales and seals have muscles with a particularly high abundance of myoglobin. Myoglobin is found in Type I, Type II A and Type II B muscle; however several studies indicate myoglobinis not found in smooth muscle.
Molecular Mass : 18.7 kDa
AA Sequence : MHHHHHHDDDDKMGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE
Storage : Stable up to 6 months at lower than -70 centigrade from date of receipt.
Stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Liquid after a 0.22 μm filtered solution in 20 mM Tris-HCl, 1 mM DTT, 100 mM NaC land 20% glycerol, pH 8.0.
Gene Name MB myoglobin [ Homo sapiens (human) ]
Official Symbol MB
Synonyms MB; myoglobin; PVALB; myoglobin
Gene ID 4151
mRNA Refseq NM_005368
Protein Refseq NP_005359
MIM 160000
UniProt ID P02144

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MB Products

Required fields are marked with *

My Review for All MB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon