Recombinant Pig NGF protein, His-SUMO-tagged
Cat.No. : | NGF-4462P |
Product Overview : | Recombinant Pig NGF protein(Q29074)(110-229aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 110-229aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NGF nerve growth factor (beta polypeptide) [ Sus scrofa ] |
Official Symbol | NGF |
Synonyms | NGF; nerve growth factor (beta polypeptide); NGFB; |
Gene ID | 407605 |
◆ Recombinant Proteins | ||
Ngf-1827M | Recombinant Mouse Ngf Protein, His-tagged | +Inquiry |
NGF-6444H | Recombinant Human NGF protein, His&Myc-tagged | +Inquiry |
NGF-092H | Active Recombinant Human NGF Protein | +Inquiry |
Ngf-09M | Mouse Nerve Growth Factor, Liquid | +Inquiry |
NGF-4655H | Recombinant Human NGF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *