Recombinant Pig SNCA protein, His-tagged
Cat.No. : | SNCA-4475P |
Product Overview : | Recombinant Pig SNCA protein(Q3I5G7)(1-140aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Sus scrofa ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); alpha-synuclein; alpha synuclein; |
Gene ID | 641350 |
mRNA Refseq | NM_001037145 |
Protein Refseq | NP_001032222 |
◆ Recombinant Proteins | ||
SNCA-3392L | Recombinant Lagothrix lagotricha (Common woolly monkey) SNCA, His-tagged | +Inquiry |
SNCA-6239C | Recombinant Chicken SNCA | +Inquiry |
SNCA-240H | Active Recombinant Human SNCA protein | +Inquiry |
SNCA-5124H | Recombinant Human Synuclein, Alpha (Non A4 Component Of Amyloid Precursor) | +Inquiry |
Snca-7340M | Recombinant Mouse Snca Protein | +Inquiry |
◆ Native Proteins | ||
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket