Recombinant Pongo pygmaeus abelii CNTNAP2 Protein(35-181aa), His-tagged
Cat.No. : | CNTNAP2-4532P |
Product Overview : | Recombinant Pongo pygmaeus abelii CNTNAP2 Protein(35-181aa)(Q5RD64), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo pygmaeus abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | 35-181aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | CDEPLVSGLPHGAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPVIARYVRVVPLDWNGEGRIGLRIEVYGC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
CNTNAP2-5974H | Recombinant Human CNTNAP2 protein, His-tagged | +Inquiry |
CNTNAP2-4262HFL | Recombinant Full Length Human CNTNAP2 protein, Flag-tagged | +Inquiry |
Cntnap2-3316M | Recombinant Mouse Cntnap2, His tagged | +Inquiry |
CNTNAP2-4532P | Recombinant Pongo pygmaeus abelii CNTNAP2 Protein(35-181aa), His-tagged | +Inquiry |
Cntnap2-2229M | Recombinant Mouse Cntnap2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTNAP2-2194MCL | Recombinant Mouse CNTNAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTNAP2 Products
Required fields are marked with *
My Review for All CNTNAP2 Products
Required fields are marked with *