Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged

Cat.No. : DEFB126-1379P
Product Overview : Recombinant Pongo Pygmaeus (Bornean orangutan) DEFB126 Protein (21-63 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
Description : Has antibacterial activity. Curated
Source : Yeast
Species : Pongo Pygmaeus
Tag : GST
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.9 kDa
Protein length : 21-63 aa
AA Sequence : SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms : DEFB126; Defensin; beta 126;
UniProt ID : A4H244
Synonyms : DEFB126; Defensin; beta 126;
UniProt ID : A4H244

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends