Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged
Cat.No. : | DEFB126-1379P |
Product Overview : | Recombinant Pongo Pygmaeus (Bornean orangutan) DEFB126 Protein (21-63 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | Has antibacterial activity. Curated |
Source : | Yeast |
Species : | Pongo Pygmaeus |
Tag : | GST |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.9 kDa |
Protein length : | 21-63 aa |
AA Sequence : | SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms : | DEFB126; Defensin; beta 126; |
UniProt ID : | A4H244 |
Synonyms : | DEFB126; Defensin; beta 126; |
UniProt ID : | A4H244 |
Products Types
◆ Recombinant Protein | ||
DEFB126-206C | Recombinant Cynomolgus Monkey DEFB126 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB126-460C | Recombinant Cynomolgus DEFB126 Protein, His-tagged | +Inquiry |
DEFB126-2232H | Recombinant Human DEFB126 Protein (Asn21-Gly111), N-GST tagged | +Inquiry |
DEFB126-1550H | Recombinant Human DEFB126 protein, His & GST-tagged | +Inquiry |
◆ Lysates | ||
DEFB126-6982HCL | Recombinant Human DEFB126 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket