Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged
Cat.No. : | DEFB126-1379P |
Product Overview : | Recombinant Pongo Pygmaeus (Bornean orangutan) DEFB126 Protein (21-63 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Pygmaeus |
Source : | Yeast |
Tag : | GST |
Protein Length : | 21-63 aa |
Description : | Has antibacterial activity. Curated |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.9 kDa |
AA Sequence : | SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | DEFB126; Defensin; beta 126; |
UniProt ID | A4H244 |
◆ Recombinant Proteins | ||
DEFB126-2232H | Recombinant Human DEFB126 Protein (Asn21-Gly111), N-GST tagged | +Inquiry |
DEFB126-460C | Recombinant Cynomolgus DEFB126 Protein, His-tagged | +Inquiry |
DEFB126-1550H | Recombinant Human DEFB126 protein, His & GST-tagged | +Inquiry |
DEFB126-206C | Recombinant Cynomolgus Monkey DEFB126 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB126-1379P | Recombinant Pongo Pygmaeus DEFB126 Protein (21-63 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB126-6982HCL | Recombinant Human DEFB126 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB126 Products
Required fields are marked with *
My Review for All DEFB126 Products
Required fields are marked with *
0
Inquiry Basket