Recombinant Pongo Pygmaeus GPX4 Protein (1-170 aa), His-SUMO-tagged
Cat.No. : | GPX4-1903P |
Product Overview : | Recombinant Pongo Pygmaeus (Bornean orangutan) GPX4 Protein (1-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Pygmaeus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-170 aa |
Description : | Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.0 kDa |
AA Sequence : | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | GPX4; Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4; |
UniProt ID | Q4AEH2 |
◆ Recombinant Proteins | ||
GPX4-2333R | Recombinant Rat GPX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX4-22H | Recombinant Human GPX4 Protein, His-tagged | +Inquiry |
GPX4-027H | Recombinant Human GPX4 Protein, His-tagged | +Inquiry |
GPX4-13510H | Recombinant Human GPX4, GST-tagged | +Inquiry |
GPX4-1895H | Recombinant Human GPX4 Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX4-308HCL | Recombinant Human GPX4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX4 Products
Required fields are marked with *
My Review for All GPX4 Products
Required fields are marked with *