Recombinant Pongo Pygmaeus GPX4 Protein (1-170 aa), His-SUMO-tagged

Cat.No. : GPX4-1903P
Product Overview : Recombinant Pongo Pygmaeus (Bornean orangutan) GPX4 Protein (1-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pongo Pygmaeus
Source : E.coli
Tag : His&SUMO
Protein Length : 1-170 aa
Description : Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.0 kDa
AA Sequence : MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms GPX4; Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4;
UniProt ID Q4AEH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX4 Products

Required fields are marked with *

My Review for All GPX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon