Recombinant Porphyromonas Gingivalis RGPB Protein (230-473 aa), His-SUMO-tagged
Cat.No. : | RGPB-1891P |
Product Overview : | Recombinant Porphyromonas Gingivalis (strain ATCC BAA-308/W83) RGPB Protein (230-473 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porphyromonas Gingivalis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 230-473 aa |
Description : | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.3 kDa |
AA Sequence : | YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | rgpB; Arg-gingipain Gingipain 2 RGP-2; |
UniProt ID | P95493 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGPB Products
Required fields are marked with *
My Review for All RGPB Products
Required fields are marked with *