Recombinant Portulaca Grandiflora DODA Protein (1-271 aa), His-SUMO-Myc-tagged

Cat.No. : DODA-2177P
Product Overview : Recombinant Portulaca Grandiflora (Rose moss) DODA Protein (1-271 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Portulaca Grandiflora
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-271 aa
Description : Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 49.9 kDa
AA Sequence : MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms DODA;
UniProt ID Q7XA48

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DODA Products

Required fields are marked with *

My Review for All DODA Products

Required fields are marked with *

0
cart-icon
0
compare icon