Recombinant Pseudomonas Aeruginosa LASB Protein (198-498 aa), His-SUMO-tagged

• Cat.No.: LASB-1921P
• Product Overview: Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) LASB Protein (198-498 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Pseudomonas Aeruginosa
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 198-498 aa
• Description: Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous pro-aminopeptidase (PubMed:11533066). Autocatalyses processing of its pro-peptide (PubMed:9642203, PubMed:1744034). Processes the pro-peptide of pro-chitin-binding protein (cbpD) (PubMed:9642203). Involved in the pathogenesis of P.aeruginosa infections.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.1 kDa
• AA Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: lasB elastase LasB [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: LASB
• Synonyms: lasB; Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain: Pro-elastase
• Gene ID: 880368
• Protein Refseq: NP_252413
• UniProt ID: P14756