Recombinant Pseudomonas aeruginosa PA0833 Protein
| Cat.No. : | PA0833-118P |
| Product Overview : | Recombinant Pseudomonas aeruginosa PA0833 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas aeruginosa |
| Source : | E.coli |
| Description : | OmpA-like domain-containing protein |
| Form : | Liquid. In 100mM NaH2PO4 100mM Tris 4M Urea pH8.0. |
| Molecular Mass : | ~10.4 kDa |
| AA Sequence : | SFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTRLSTRGMGPDQPIASNSTADGRAQNRRVEVNLRPVPGAQGPAQTQPQY |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.5 mg/ml |
| Gene Name | PA0833 hypothetical protein [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol | PA0833 |
| Gene ID | 878406 |
| Protein Refseq | NP_249524 |
| UniProt ID | Q9I5A7 |
| ◆ Recombinant Proteins | ||
| PA0833-118P | Recombinant Pseudomonas aeruginosa PA0833 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PA0833 Products
Required fields are marked with *
My Review for All PA0833 Products
Required fields are marked with *



