Recombinant Pseudomonas aeruginosa PA0833 Protein

• Cat.No.: PA0833-118P
• Product Overview: Recombinant Pseudomonas aeruginosa PA0833 Protein was expressed in E. coli.

Specification

• Species: Pseudomonas aeruginosa
• Source: E.coli
• Description: OmpA-like domain-containing protein
• Form: Liquid. In 100mM NaH2PO4 100mM Tris 4M Urea pH8.0.
• Molecular Mass: ~10.4 kDa
• AA Sequence: SFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTRLSTRGMGPDQPIASNSTADGRAQNRRVEVNLRPVPGAQGPAQTQPQY
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.5 mg/ml

Gene Information

• Gene Name: PA0833 hypothetical protein [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: PA0833
• Gene ID: 878406
• Protein Refseq: NP_249524
• UniProt ID: Q9I5A7