Recombinant Pseudomonas aeruginosa PA4877 Protein

• Cat.No.: PA4877-143P
• Product Overview: Recombinant Pseudomonas aeruginosa PA4877 Protein was expressed in E. coli.

Specification

• Species: Pseudomonas aeruginosa
• Source: E.coli
• Description: hypothetical protein
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~15 kDa
• AA Sequence: MPRGDKSKYSDKQQRKAEHIEESYKAKGVSESEAEARAWATVNKQSGGGERKGGSGRAKSETAKRADRKDSAHRAAQARSGRPANRGSASRGKRQGSTSVSEMTREELMQLARKRDIRGRSTMRKAELIEALSRA
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.7 mg/ml

Gene Information

• Gene Name: PA4877 hypothetical protein [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: PA4877
• Gene ID: 882233
• Protein Refseq: NP_253564
• UniProt ID: Q9HUT6