Recombinant Pseudomonas Aeruginosa PSCF Protein (2-85 aa), His-Myc-tagged

• Cat.No.: PSCF-2686P
• Product Overview: Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/DSM 22644/CIP 104116/JCM 14847/LMG 12228/1C/PRS 101/PAO1) PSCF Protein (2-85 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Pseudomonas Aeruginosa
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-85 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.6 kDa
• AA Sequence: AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: pscF type III export protein PscF [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: PSCF
• Synonyms: pscF
• Gene ID: 879634
• Protein Refseq: NP_250410
• UniProt ID: P95434