Recombinant Pseudomonas Aeruginosa PSCF Protein (2-85 aa), His-Myc-tagged

Cat.No. : PSCF-2686P
Product Overview : Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/DSM 22644/CIP 104116/JCM 14847/LMG 12228/1C/PRS 101/PAO1) PSCF Protein (2-85 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pseudomonas Aeruginosa
Source : E.coli
Tag : His&Myc
Protein Length : 2-85 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.6 kDa
AA Sequence : AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name pscF type III export protein PscF [ Pseudomonas aeruginosa PAO1 ]
Official Symbol PSCF
Synonyms pscF;
Gene ID 879634
Protein Refseq NP_250410
UniProt ID P95434

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSCF Products

Required fields are marked with *

My Review for All PSCF Products

Required fields are marked with *

0
cart-icon
0
compare icon