Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PR rplL protein, His-tagged
| Cat.No. : | rplL-4611P |
| Product Overview : | Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PR rplL protein(Q9HWC8)(1-122 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas aeruginosa |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-122 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 18.5 kDa |
| AASequence : | MALTNEDIINAVSEMSVMQVVELIKAMEEKFGVTAAAATVAAAGPAAAAAEEQTEFTIVLAEAGDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEEAEAAKKALEEAGAKVELK |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All rplL Products
Required fields are marked with *
My Review for All rplL Products
Required fields are marked with *
