Species : |
Pseudomonas Putida |
Source : |
E.coli |
Tag : |
His&Myc&SUMO |
Protein Length : |
1-307 aa |
Description : |
This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation. |
Form : |
Tris-based buffer,50% glycerol |
Molecular Mass : |
55.2 kDa |
AA Sequence : |
MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT |
Purity : |
> 90% as determined by SDS-PAGE. |
Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : |
A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |