Recombinant Pseudomonas Putida XYLE Protein (1-307 aa), His-SUMO-Myc-tagged

Cat.No. : XYLE-2244P
Product Overview : Recombinant Pseudomonas Putida (Arthrobacter siderocapsulatus) XYLE Protein (1-307 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pseudomonas Putida
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-307 aa
Description : This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 55.2 kDa
AA Sequence : MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name xylE xylE [ Pseudomonas putida ]
Official Symbol XYLE
Synonyms xylE; CatO2ase Catechol 2,3-dioxygenase;
Gene ID 1218746
Protein Refseq NP_542866
UniProt ID P06622

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XYLE Products

Required fields are marked with *

My Review for All XYLE Products

Required fields are marked with *

0
cart-icon