Recombinant Pseudomonas Syringae Pv. Tomato DSDA Protein (23-214 aa), His-tagged

• Cat.No.: DSDA-993P
• Product Overview: Recombinant Pseudomonas Syringae Pv. Tomato (strain ATCC BAA-871/DC3000) DSDA Protein (23-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Pseudomonas Syringae Pv. Tomato
• Source: E.coli
• Tag: His
• Protein Length: 23-214 aa
• Description: Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 25.1 kDa
• AA Sequence: AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• UniProt ID: O52376