Recombinant Pseudomonas Syringae Pv. Tomato DSDA Protein (23-214 aa), His-tagged
| Cat.No. : | DSDA-993P |
| Product Overview : | Recombinant Pseudomonas Syringae Pv. Tomato (strain ATCC BAA-871/DC3000) DSDA Protein (23-214 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pseudomonas Syringae Pv. Tomato |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-214 aa |
| Description : | Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| UniProt ID | O52376 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSDA Products
Required fields are marked with *
My Review for All DSDA Products
Required fields are marked with *
