Recombinant Pyrococcus Furiosus ALBA Protein (1-93 aa), His-SUMO-tagged
Cat.No. : | ALBA-1917P |
Product Overview : | Recombinant Pyrococcus Furiosus (strain ATCC 43587/DSM 3638/JCM 8422/Vc1) ALBA Protein (1-93 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrococcus Furiosus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-93 aa |
Description : | Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | albA; |
UniProt ID | Q8TZV1 |
◆ Recombinant Proteins | ||
ALBA-1917P | Recombinant Pyrococcus Furiosus ALBA Protein (1-93 aa), His-SUMO-tagged | +Inquiry |
ALBA-0622B | Recombinant Bacillus subtilis ALBA protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALBA Products
Required fields are marked with *
My Review for All ALBA Products
Required fields are marked with *
0
Inquiry Basket