Recombinant Pyrococcus Horikoshii NADB Protein (1-464 aa), His-SUMO-Myc-tagged
Cat.No. : | NADB-2290P |
Product Overview : | Recombinant Pyrococcus Horikoshii (strain ATCC 700860/DSM 12428/JCM 9974/NBRC 100139) NADB Protein (1-464 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrococcus Horikoshii |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-464 aa |
Description : | Catalyzes the oxidation of L-aspartate to iminoaspartate. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 71.3 kDa |
AA Sequence : | MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | nadB; |
UniProt ID | O57765 |
◆ Recombinant Proteins | ||
NADB-1021B | Recombinant Bacillus subtilis NADB protein, His-tagged | +Inquiry |
nadB-852 | Recombinant E. coli nadB Protein | +Inquiry |
nadB-01E | Active Recombinant E. coli L-Aspartate Oxidase (EC 1.4.3.16) | +Inquiry |
nadB-3866E | Recombinant Escherichia coli nadB protein, His&Myc-tagged | +Inquiry |
NADB-2290P | Recombinant Pyrococcus Horikoshii NADB Protein (1-464 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NADB Products
Required fields are marked with *
My Review for All NADB Products
Required fields are marked with *
0
Inquiry Basket