Recombinant R. japonica 17 kDa surface Antigen, His-SUMO-tagged

Cat.No. : omp-1306R
Product Overview : Recombinant R. japonica 17 kDa surface Antigen (20-159aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : R.japonica
Source : E.coli
Tag : His&SUMO
Protein Length : 20-159 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 30.5 kDa
AA Sequence : CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQR
ALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name 17 kDa surface antigen
Official Symbol 17 kDa surface antigen
Synonyms 17 kDa surface antigen; omp
UniProt ID Q52764

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All 17 kDa surface antigen Products

Required fields are marked with *

My Review for All 17 kDa surface antigen Products

Required fields are marked with *

0
cart-icon