Recombinant R. japonica 17 kDa surface Antigen, His-SUMO-tagged
Cat.No. : | omp-1306R |
Product Overview : | Recombinant R. japonica 17 kDa surface Antigen (20-159aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | R.japonica |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-159 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQR ALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | 17 kDa surface antigen |
Official Symbol | 17 kDa surface antigen |
Synonyms | 17 kDa surface antigen; omp |
UniProt ID | Q52764 |
◆ Recombinant Proteins | ||
omp-1306R | Recombinant R. japonica 17 kDa surface Antigen, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All 17 kDa surface antigen Products
Required fields are marked with *
My Review for All 17 kDa surface antigen Products
Required fields are marked with *