Recombinant Rabbit IFN gamma

• Cat.No.: IFNg-28R
• Product Overview: Rabbit IFN gamma was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Rabbit
• Source: Yeast
• Tag: Non
• Description: Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
• Form: Lyophilized
• Molecular Mass: 16.9 kDa
• AA Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVS FYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNL TRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRG RRASKY (144)
• Applications: The rabbit IFN gamma protein can be used in cell culture, as a IFN gamma ELISA Standard, and as a Western Blot Control.
• Storage: -20 C

Gene Information

• Gene Name: IFNG interferon, gamma [ Oryctolagus cuniculus ]
• Official Symbol: IFNg
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN gamma; IFN-gamma
• Gene ID: 100008602
• mRNA Refseq: NM_001081991
• Protein Refseq: NP_001075460