Recombinant Rabbit IFN gamma
| Cat.No. : | IFNg-28R |
| Product Overview : | Rabbit IFN gamma was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | Yeast |
| Tag : | Non |
| Description : | Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
| Form : | Lyophilized |
| Molecular Mass : | 16.9 kDa |
| AA Sequence : | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVS FYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNL TRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRG RRASKY (144) |
| Applications : | The rabbit IFN gamma protein can be used in cell culture, as a IFN gamma ELISA Standard, and as a Western Blot Control. |
| Storage : | -20 C |
| Gene Name | IFNG interferon, gamma [ Oryctolagus cuniculus ] |
| Official Symbol | IFNg |
| Synonyms | IFNG; interferon, gamma; interferon gamma; IFN gamma; IFN-gamma; |
| Gene ID | 100008602 |
| mRNA Refseq | NM_001081991 |
| Protein Refseq | NP_001075460 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNg Products
Required fields are marked with *
My Review for All IFNg Products
Required fields are marked with *
