Recombinant Rabbit IFN gamma

Cat.No. : IFNg-28R
Product Overview : Rabbit IFN gamma was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : Yeast
Tag : Non
Description : Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
Form : Lyophilized
Molecular Mass : 16.9 kDa
AA Sequence : QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVS FYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNL TRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRG RRASKY (144)
Applications : The rabbit IFN gamma protein can be used in cell culture, as a IFN gamma ELISA Standard, and as a Western Blot Control.
Storage : -20 C
Gene Name IFNG interferon, gamma [ Oryctolagus cuniculus ]
Official Symbol IFNg
Synonyms IFNG; interferon, gamma; interferon gamma; IFN gamma; IFN-gamma;
Gene ID 100008602
mRNA Refseq NM_001081991
Protein Refseq NP_001075460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNg Products

Required fields are marked with *

My Review for All IFNg Products

Required fields are marked with *

0
cart-icon
0
compare icon