Recombinant Rabbit IgA1, His tagged
Cat.No. : | IgA1-242R |
Product Overview : | Recombinant Rabbit IgA1 with His tag was expressed in E. coli. |
Availability | September 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-307 aa |
Molecular Mass : | 34 kDa |
AA Sequence : | MCLIQGFFPLGPLSVKWTISGENVTFPPVQLDTSGLYTTSSLLNLTDEECPTCVACHVEHNEVDRYLILPCPDTHSSCPPTSCGEPSLSLQRPDLRDLLLGSDASLTCTLRGLKDPKDAVFTWEPTNGNEPVQQSPQRDPCGCYSVSSVLPGCAEPWNAGTEFTCTVTHPEIEGGSLTATISKDTGSLTPPLVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVYWTNKGVVVPKDSFLVWKPLPEPGQEPTTYAVTSLLRVPAEDWNQGDSYSCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.65 mg/mL by BCA |
Synonyms | IgA1; Immunoglobulin A1 |
◆ Recombinant Proteins | ||
IgA1-20H | Recombinant Human Full Length IgA1 | +Inquiry |
IgA1-2693H | Recombinant Human IgA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA1-242R | Recombinant Rabbit IgA1, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA1 Products
Required fields are marked with *
My Review for All IgA1 Products
Required fields are marked with *