Recombinant Rabbit IgA1, His tagged
| Cat.No. : | IgA1-242R |
| Product Overview : | Recombinant Rabbit IgA1 with His tag was expressed in E. coli. |
| Availability | November 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-307 aa |
| Molecular Mass : | 34 kDa |
| AA Sequence : | MCLIQGFFPLGPLSVKWTISGENVTFPPVQLDTSGLYTTSSLLNLTDEECPTCVACHVEHNEVDRYLILPCPDTHSSCPPTSCGEPSLSLQRPDLRDLLLGSDASLTCTLRGLKDPKDAVFTWEPTNGNEPVQQSPQRDPCGCYSVSSVLPGCAEPWNAGTEFTCTVTHPEIEGGSLTATISKDTGSLTPPLVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVYWTNKGVVVPKDSFLVWKPLPEPGQEPTTYAVTSLLRVPAEDWNQGDSYSCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.65 mg/mL by BCA |
| Synonyms | IgA1; Immunoglobulin A1 |
| ◆ Recombinant Proteins | ||
| IgA1-20H | Recombinant Human Full Length IgA1 | +Inquiry |
| IgA1-242R | Recombinant Rabbit IgA1, His tagged | +Inquiry |
| IgA1-2693H | Recombinant Human IgA1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA1 Products
Required fields are marked with *
My Review for All IgA1 Products
Required fields are marked with *
