Recombinant Rabbit IgA14, His tagged
| Cat.No. : | IgA14-245R |
| Product Overview : | Recombinant Rabbit IgA14 (1-318 aa) with C-His tag was expressed in E. coli. |
| Availability | June 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | AXM43016.1 1-318 aa |
| Source : | E. coli |
| Species : | Rabbit |
| Tag : | C-His |
| Molecular Weight : | 36 kDa |
| AA Sequence : | MCLIRGFFPLGPLSVSWNVSGTNMNFPPVPSPPSNLYTTCSLLILPPEECPAGNCVACHVEHNDDEGQDLTVPCPPEDPCKNCPTISRSRFTAHCQPSLSLQRPDLGDLLLGRDASLTCTLSGLKDPEGTVFTWEPTNGKEPVQQSPQRDLSGGYSVSSVLPGCAEPWNAGKKFTCTVTHPEIDSGSLIATISKDTGVITPPQVHLLPPPTEELALNELVTLTCLVRGFSPKDVLVSWKHQGQEVSQDRYLVWKPLPEPGQEPTTYAVTSLLRVSAEDWNQGDSYSCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Concentration : | 0.5 mg/mL by BCA |
| Official Symbol | IgA14 |
| ◆ Recombinant Proteins | ||
| IgA14-245R | Recombinant Rabbit IgA14, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA14 Products
Required fields are marked with *
My Review for All IgA14 Products
Required fields are marked with *
