Recombinant Rabbit IgA2, His tagged
Cat.No. : | IgA2-243R |
Product Overview : | Recombinant Rabbit IgA2 (1-324 aa) with C-His tag was expressed in E. coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His |
Protein Length : | AXM43009.1 1-324 aa |
Source : | E. coli |
Species : | Rabbit |
Tag : | C-His |
Molecular Weight : | 36 kDa |
AA Sequence : | MCLIRGFFPLGPLKVTWNVSGESVIFPPIPSPPSSLYTTYSLLRLPAEQCPEENSVACRVEHNNKGQDVTVPSPPACNESTIEPPTTPTCPCPCPSPSCGKPSLSLQRPDLGDLLLNSNASLTCTLRGLLNPEGAVFTWEPTFGKEPVQQSPQLDHCGCYSVSSVLPGCAVLWNAGTELTCTVTHPDIEGGSLTGTISKDTGSLIPPQVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVSWTHNGTPVVPKDSYLVWKPLPEPGQDPTTYAVTSLLRVPAEDWNQGDSYSCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 20mM Tris, pH8.0, 200mM NaCl |
Concentration : | 0.23 mg/mL by BCA |
Official Symbol | IgA2 |
◆ Recombinant Proteins | ||
IgA2-243R | Recombinant Rabbit IgA2, His tagged | +Inquiry |
◆ Native Proteins | ||
IgA2-06H | Biotinylated Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA2 Products
Required fields are marked with *
My Review for All IgA2 Products
Required fields are marked with *