Recombinant Rabbit IgA2, His tagged
| Cat.No. : | IgA2-243R |
| Product Overview : | Recombinant Rabbit IgA2 (1-324 aa) with C-His tag was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | AXM43009.1 1-324 aa |
| Source : | E. coli |
| Species : | Rabbit |
| Tag : | C-His |
| Molecular Weight : | 36 kDa |
| AA Sequence : | MCLIRGFFPLGPLKVTWNVSGESVIFPPIPSPPSSLYTTYSLLRLPAEQCPEENSVACRVEHNNKGQDVTVPSPPACNESTIEPPTTPTCPCPCPSPSCGKPSLSLQRPDLGDLLLNSNASLTCTLRGLLNPEGAVFTWEPTFGKEPVQQSPQLDHCGCYSVSSVLPGCAVLWNAGTELTCTVTHPDIEGGSLTGTISKDTGSLIPPQVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVSWTHNGTPVVPKDSYLVWKPLPEPGQDPTTYAVTSLLRVPAEDWNQGDSYSCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 20mM Tris, pH8.0, 200mM NaCl |
| Concentration : | 0.23 mg/mL by BCA |
| Official Symbol | IgA2 |
| ◆ Recombinant Proteins | ||
| IgA2-243R | Recombinant Rabbit IgA2, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
| IgA2-06H | Biotinylated Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA2 Products
Required fields are marked with *
My Review for All IgA2 Products
Required fields are marked with *
