Recombinant Rabbit IgA4 Protein, His tagged
Cat.No. : | IgA4-239R |
Product Overview : | Recombinant Rabbit IgA4 Protein with His tag was expressed in E. coli. |
Availability | May 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His |
Source : | E. coli |
Species : | Rabbit |
Tag : | C-His |
Molecular Weight : | 36 kDa |
AA Sequence : | MCLIRGFFPRGPLSVTWNDNRANLTFPPVQSATSSLYTTCSVLSLPAEQCPAGNSVACRVEHNNKGQDLTVPCLACNKPTIEPPTKPTCPCPCPSPSCGKPSLSLQRPDLGDLLLDSNASLTCTLRGLLNPEGAVFTWNPTNGKEPVQQSAQRDHCGCYSVSSVLPGCAEPWNAGTVFTCTVTHPEIDSGSLTATISKDTGSLIPPQVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVYWTNKGLQVPKDSFLVWKPLPEPGQEPTTYAVTSLLRVPAEDWNQNESYTCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 20% Glycerol |
Concentration : | 0.46 mg/mL by BCA |
Official Symbol | IgA4 |
◆ Recombinant Proteins | ||
IgA4-239R | Recombinant Rabbit IgA4 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IgA4 Products
Required fields are marked with *
My Review for All IgA4 Products
Required fields are marked with *
0
Inquiry Basket