Recombinant Rabbit IgA5 Protein, His tagged
| Cat.No. : | IgA5-240R |
| Product Overview : | Recombinant Rabbit IgA5 Protein with His tag was expressed in E. coli. |
| Availability | July 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His |
| Source : | E. coli |
| Species : | Rabbit |
| Tag : | C-His |
| Molecular Weight : | 36 kDa |
| AA Sequence : | MCLIRGFFPRGPLSVSWNASGKNVTFPPVPSGTSGPYTTCSLLSLTPEQCPEDDNVVCHVEHYDEGQDLTVLYPECQPPTPSPTTPTTATTSGPTPSCGEPSLSLQRPDLGDLLLNSNASLTCTLRGLLDPEGAVFTWEPTNGNEPVQLSPKLDHCGCYSVSSVLPGCAAAWNAGTKFNCTVTHPEIEGGSLTDIISKDTGVVIAPQVHLLPPPSEELALNALVTLTCLVRGFSPKDVLVYWTNKGVAVPKDRYLVWKPLPEPGQDPTTYAVTSLLRVPAEDWNQNESYTCVVGHEGLAEHFTQKTIDRLAGKPTHVNVSVVVHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 20% Glycerol |
| Concentration : | 0.31 mg/mL by BCA |
| Official Symbol | IgA5 |
| ◆ Recombinant Proteins | ||
| IgA5-240R | Recombinant Rabbit IgA5 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA5 Products
Required fields are marked with *
My Review for All IgA5 Products
Required fields are marked with *




