Recombinant Rabbit IGF2 Protein
Cat.No. : | IGF2-99R |
Product Overview : | Recombinant rabbit IGF-2 protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Description : | Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 is preferentially expressed in early embryonic and fetal development and in a wide variety of somatic tissues. IGF-2 expression in adults occurs in liver and in epithelial cells lining the surface of the brain. IGF-2 is present in circulation and can be detected in plasma, with circulating IGF-2 levels highest in fetal circulation. |
Molecular Mass : | 7.5 kDa |
AA Sequence : | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVNRRSRGIVEECCFRSCDLALLETYCATPAKSE(67) |
Applications : | The swine/rabbit/dolphin IGF-2 endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
Gene Name | IGF2 insulin-like growth factor 2 (somatomedin A) [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | IGF2 |
Synonyms | IGF2; insulin-like growth factor 2 (somatomedin A); insulin-like growth factor II |
Gene ID | 100328792 |
mRNA Refseq | NM_001171406 |
Protein Refseq | NP_001164877 |
UniProt ID | B7NZU3 |
◆ Recombinant Proteins | ||
IGF2-462H | Recombinant Human IGF2, 1-104 aa | +Inquiry |
IGF2-2501H | Recombinant Human IGF2 Protein (Ala25-Glu91), His tagged | +Inquiry |
IGF2-559H | Recombinant Human IGF2 Protein, Fc-tagged | +Inquiry |
IGF2-609H | Recombinant Human Insulin-like Growth Factor 2 (somatomedin A) | +Inquiry |
IGF2-01H | Recombinant Human IGF2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IGF2-29116TH | Native Human IGF2 | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *
0
Inquiry Basket