Recombinant Rabbit TFPI protein, His-tagged
Cat.No. : | TFPI-2260R |
Product Overview : | Recombinant Rabbit TFPI protein(P19761)(25-300aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 25-300aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.3 kDa |
AA Sequence : | AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) [ Oryctolagus cuniculus ] |
Official Symbol | TFPI |
Synonyms | TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); tissue factor pathway inhibitor; extrinsic pathway inhibitor; lipoprotein-associated coagulation inhibitor; EPI; LACI; |
Gene ID | 100009401 |
mRNA Refseq | NM_001101714 |
Protein Refseq | NP_001095184 |
◆ Recombinant Proteins | ||
TFPI-106H | Recombinant Human TFPI protein, His/GST-tagged | +Inquiry |
TFPI-4683R | Recombinant Rhesus macaque TFPI protein, His-tagged | +Inquiry |
TFPI-5070R | Recombinant Rabbit TFPI protein, His-tagged | +Inquiry |
Tfpi-981M | Active Recombinant Mouse Tfpi protein(Met1-Lys289), His-tagged | +Inquiry |
TFPI-3565H | Recombinant Human TFPI protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
TFPI-2843MCL | Recombinant Mouse TFPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI Products
Required fields are marked with *
My Review for All TFPI Products
Required fields are marked with *