Recombinant Rabbit TNFSF13 Protein
Cat.No. : | TNFSF13-13R |
Product Overview : | The Rabbit APRIL recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Description : | Tumor necrosis factor ligand superfamily member 13 (TNFSF13) also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18). APRIL/TNFSF13 is expressed by macrophages and dendritic cells. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. |
Molecular Mass : | 16.5kDa |
AA Sequence : | ALPTQKQKKKRSLLHLVPINITSKEDSDVTEVMWQPALRRGRGLEAQGYVVRVWDTGVYLLYSQVLFHDVTFTMGQVVSREGQGRQETLFRCVCSMPSDPDRAYNSCYSAGVFHLHQGDILSVVIPRARAKFSLSPHGTFLGFVKL(146) |
Applications : | The APRIL endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control. |
Gene Name | TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Oryctolagus cuniculus ] |
Official Symbol | TNFSF13 |
Synonyms | TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; proliferation-inducing ligand |
Gene ID | 100126074 |
mRNA Refseq | NM_001105676 |
Protein Refseq | NP_001099146 |
UniProt ID | A7XIF3 |
◆ Recombinant Proteins | ||
TNFSF13-1480H | Recombinant Human TNFSF13 Protein (Met1-Leu250), N-His tagged | +Inquiry |
TNFSF13-25R | Recombinant Rhesus monkey TNFSF13 protein, His-tagged | +Inquiry |
TNFSF13-399H | Active Recombinant Human TNFSF13, FLAG-tagged | +Inquiry |
Tnfsf13-155M | Active Recombinant Mouse Tnfsf13 Protein | +Inquiry |
TNFSF13-754C | Recombinant Cynomolgus TNFSF13 protein, His-Avi,Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF13 Products
Required fields are marked with *
My Review for All TNFSF13 Products
Required fields are marked with *