Recombinant Rabbit TNFSF13 Protein

Cat.No. : TNFSF13-13R
Product Overview : The Rabbit APRIL recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : Yeast
Description : Tumor necrosis factor ligand superfamily member 13 (TNFSF13) also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha (TNFSF2), Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL(TNFSF13), BAFF (TNFSF13B), LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18). APRIL/TNFSF13 is expressed by macrophages and dendritic cells. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.
Molecular Mass : 16.5kDa
AA Sequence : ALPTQKQKKKRSLLHLVPINITSKEDSDVTEVMWQPALRRGRGLEAQGYVVRVWDTGVYLLYSQVLFHDVTFTMGQVVSREGQGRQETLFRCVCSMPSDPDRAYNSCYSAGVFHLHQGDILSVVIPRARAKFSLSPHGTFLGFVKL(146)
Applications : The APRIL endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control.
Gene Name TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Oryctolagus cuniculus ]
Official Symbol TNFSF13
Synonyms TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; proliferation-inducing ligand
Gene ID 100126074
mRNA Refseq NM_001105676
Protein Refseq NP_001099146
UniProt ID A7XIF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF13 Products

Required fields are marked with *

My Review for All TNFSF13 Products

Required fields are marked with *

0
cart-icon