Recombinant Rabbit VDAC2 protein
Cat.No. : | VDAC2-5012R |
Product Overview : | Recombinant Rabbit VDAC2 protein(P68003)(1-36 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Tag : | Non |
Protein Length : | 1-36 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | MATYGQPCARPMCIPPSYADLGKAARDIFNKGFGFG |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | VDAC2 voltage-dependent anion channel 2 [ Oryctolagus cuniculus ] |
Official Symbol | VDAC2 |
Synonyms | VDAC2; voltage-dependent anion channel 2; voltage-dependent anion-selective channel protein 2; VDAC-2; outer mitochondrial membrane protein porin 2; |
Gene ID | 100009473 |
mRNA Refseq | NM_001082718 |
Protein Refseq | NP_001076187 |
◆ Recombinant Proteins | ||
VDAC2-6511R | Recombinant Rat VDAC2 Protein | +Inquiry |
VDAC2-5014R | Recombinant Rabbit VDAC2 protein, Avi-tagged, Biotinylated | +Inquiry |
VDAC2-5016R | Recombinant Rabbit VDAC2 protein | +Inquiry |
VDAC2-5012R | Recombinant Rabbit VDAC2 protein | +Inquiry |
VDAC2-3658H | Recombinant Human VDAC2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VDAC2-418HCL | Recombinant Human VDAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VDAC2 Products
Required fields are marked with *
My Review for All VDAC2 Products
Required fields are marked with *
0
Inquiry Basket