Recombinant Rabbit VDAC2 protein
| Cat.No. : | VDAC2-5013R |
| Product Overview : | Recombinant Rabbit VDAC2 protein(P68003)(1-36 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-36 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MATYGQPCARPMCIPPSYADLGKAARDIFNKGFGFG |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | VDAC2 voltage-dependent anion channel 2 [ Oryctolagus cuniculus ] |
| Official Symbol | VDAC2 |
| Synonyms | VDAC2; voltage-dependent anion channel 2; voltage-dependent anion-selective channel protein 2; VDAC-2; outer mitochondrial membrane protein porin 2; |
| Gene ID | 100009473 |
| mRNA Refseq | NM_001082718 |
| Protein Refseq | NP_001076187 |
| ◆ Recombinant Proteins | ||
| VDAC2-6167R | Recombinant Rat VDAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VDAC2-5016R | Recombinant Rabbit VDAC2 protein | +Inquiry |
| VDAC2-10007M | Recombinant Mouse VDAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VDAC2-3658H | Recombinant Human VDAC2, GST-tagged | +Inquiry |
| VDAC2-5014R | Recombinant Rabbit VDAC2 protein, Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VDAC2-418HCL | Recombinant Human VDAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VDAC2 Products
Required fields are marked with *
My Review for All VDAC2 Products
Required fields are marked with *



