Recombinant Rabbit VDAC2 protein

• Cat.No.: VDAC2-5013R
• Product Overview: Recombinant Rabbit VDAC2 protein(P68003)(1-36 aa) was expressed in E.coli.

Specification

• Species: Rabbit
• Source: E.coli
• Tag: Non
• Protein Length: 1-36 aa
• Form: Tris/PBS-based buffer, 6% Trehalose.
• AASequence: MATYGQPCARPMCIPPSYADLGKAARDIFNKGFGFG
• Purity: >85% (SDS-PAGE)
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: VDAC2 voltage-dependent anion channel 2 [ Oryctolagus cuniculus ]
• Official Symbol: VDAC2
• Synonyms: VDAC2; voltage-dependent anion channel 2; voltage-dependent anion-selective channel protein 2; VDAC-2; outer mitochondrial membrane protein porin 2
• Gene ID: 100009473
• mRNA Refseq: NM_001082718
• Protein Refseq: NP_001076187