Recombinant Rabbit VDAC2 protein, Avi-tagged, Biotinylated

Cat.No. : VDAC2-5014R
Product Overview : Biotinylated Recombinant Rabbit VDAC2 protein(P68003)(1-36 aa), fused with Avi tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : E.coli
Tag : Avi
Protein Length : 1-36 aa
Conjugation/Label : Biotin
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : MATYGQPCARPMCIPPSYADLGKAARDIFNKGFGFG
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Conjugation : Biotin
Gene Name VDAC2 voltage-dependent anion channel 2 [ Oryctolagus cuniculus ]
Official Symbol VDAC2
Synonyms VDAC2; voltage-dependent anion channel 2; voltage-dependent anion-selective channel protein 2; VDAC-2; outer mitochondrial membrane protein porin 2;
Gene ID 100009473
mRNA Refseq NM_001082718
Protein Refseq NP_001076187

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VDAC2 Products

Required fields are marked with *

My Review for All VDAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon